PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631955.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 329aa    MW: 38210.8 Da    PI: 6.7904
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631955.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.58.9e-5671361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kk+++k+++l +vike+d+yk+ePwdL++  k+ +ee+ +wyfFs++dkky+tg+r+nratk+g+Wkatg+dk++
  XP_009631955.1   7 VPPGFRFHPTDEELVDYYLRKKIASKRIDL-DVIKEIDLYKIEPWDLQElcKIGTEEQsDWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAI 100
                     69****************************.9***************954555554445************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_009631955.1 101 YR-KHILIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                     **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-605156IPR003441NAC domain
PROSITE profilePS5100559.0277156IPR003441NAC domain
PfamPF023654.6E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MNSFTHVPPG FRFHPTDEEL VDYYLRKKIA SKRIDLDVIK EIDLYKIEPW DLQELCKIGT  60
EEQSDWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YRKHILIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTTQEEGWAV CRVFKKKLAT TMRREGEHES LCWYNDDQVS  180
NFMPDFDSPR RFPNPYSATA YHNPHLAYTN NMQQPPNDAF LQLPQLESPK VPQSYGSNLN  240
QMVLPNSIYN PNNNYDHQAV DQVTDWRVLD KFVASQLSQE DGCSKMETSA VACSSSPASE  300
QMNLQLQNDF KSQEMASELA SSSQVDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754473e-92HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631955.10.0PREDICTED: NAC domain-containing protein 7
RefseqXP_009631956.10.0PREDICTED: NAC domain-containing protein 7
RefseqXP_009631957.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-135NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A061GBJ71e-158A0A061GBJ7_THECC; NAC domain protein, IPR003441 isoform 1
STRINGVIT_02s0154g00020.t011e-154(Vitis vinifera)
STRINGSolyc08g079120.1.11e-154(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-127NAC 007